.
The Open Protein Structure Annotation Network
PDB Keyword
.

390553

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390553
    Molecular Characteristics
    Source Burkholderia pseudomallei k96243
    Alias Ids TPS24405,YP_111995.1, 1.20.1260.10, 85571 Molecular Weight 41461.56 Da.
    Residues 384 Isoelectric Point 5.08
    Sequence mnpntvppaardvawikhalqtaieleystlplylsamfslevqnytaynairsiameemvhmaiaanl laalggspqfkpiqiaypttglpggaepdlhvglaryskpqlknflrietpgfllrqlgrdegyptiaa fyesirsaiarnanavraavqaggpanqvgddigfttvtykpgvdpvesfdagigeilqqgegsgrgdv fagnpfedeeshyarfaelyygaryqapsppvdfnpkneplffggpaiaapvvvntlavprdgyarila ldperdtvesdlnafdsgfskilstldavwngpsstswktlgaavhgmvdlrvlscfnimrhavpaaav sqlaelypdeigflrtytdlskpvfygprfvnvngkqas
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch