.
The Open Protein Structure Annotation Network
PDB Keyword
.

390503

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390503
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS14577,NP_981295.1, 3.40.640.10, 382585 Molecular Weight 40178.71 Da.
    Residues 367 Isoelectric Point 5.56
    Sequence mghslnakyglkrvinasgrmsilgvsaptdtvmdamkhggqnyveiadlvdkagdhiarildseaavv vnsassgialsiaaivtegnrrkserlhqeviaknevimlkghnvqygapvetmiylgggklvevgyan egkaehiedaigentaailyvkshhavqknmisveeawevaqrnniplivdaaaeediqkyvkyadlai ysgskaiegptsgivggkrkyiewlkvqlhcigrsmkvgkettfgllqaldeygvkedkseqekellqv lmplkelngvnvtivqdeagraifrarihidenelnksakdvvtalregeiaiytrdygvrqgffdidp rpllgddihvieeklreivggn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch