The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 390370
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS7718,YP_210662.1 Molecular Weight 55348.31 Da.
    Residues 489 Isoelectric Point 4.98
    Sequence ascdkfdeintdpdattkvtssllatglllditsssasksfiydellakqmawgesmedyqynvfgrsgf ggyttlinaqkmvesvsddnvnaydglahfikaykifymsmemgdlpyeealqgelglvrpkyntqkev mnfilsdletayelfstakdfdgdpilggsiskwkkattafqlkvlmhlskkesdadlkvkerfariva sgslmesnednlqmkyadkantvypfhntntkhagyamlstmlidkfkatgdirmfyyakpakaklneg vtadswdayigtdpslpfeqiekayateqysgfnarytdypsgepvvrlgyaeqnfilaeaavrgwisg dasayykkairahmefiasntpdeevyhhghpiteeaiaafletpaiqlsgekeadiekiltqrylasf mqhpydvyydyrrtgypvlpinpatnrntmndrlpmrwmypksesdynlehqnealerqfggvddvnklmwilq
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    This protein is now in the SusD family, PF12741, which has other structures from JCSG and others.

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch