.
The Open Protein Structure Annotation Network
PDB Keyword
.

390304

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390304
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS7709, Molecular Weight 20033.54 Da.
    Residues 190 Isoelectric Point 4.97
    Sequence atdsataapaaaattqvqkeaadvlqvavqganamrdiqfarlalfhgqpdsakkltddaaallaaddaswakfvk tdakakmiadryviinasialsedyvatpekesaiqsaneklakgdqkgaidtlrlagigvienqylmplnqtrk avaqsqellkagkyyeanlvlkgaeegivvdsemlvagn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    390304 encodes a protein of unknown function, representing a new PFAM family PF10938. 390304 contains a four-helix bundle substructure similar to cytochrome c-b(562) (pdb 2bc5, rmsd 2.6 for 78 aligned Ca). However,  it appears to be a novel fold if all the protein is considered (Fig 1). 390304 is likely to function as a tetramer (Fig 2). There are a few zinc ions found to be associated with the protein (crystal was obtained in 0.2M ZnAc).

    390304 is homologous to E. coli protein yfdX which is clustered with other proteins of unknown functions. yfdX is controlled by EvgS/EvgA two component signal transduction system and is probably involved in multi-drug resistence response of bacteria. The surface of the tetramer  has a distinctive feature (Fig 3) in which a negative pocket surrounded by positive patches.  Sequence conservation analysis seems to suggest that areas around Arg72 are highly conserved.

    Similar protein from Escherichia coli K12 encoded by yfdX is functionally associated with: yqgB, ymdA, ydiZ, yeiS, yfdY, yfeD, ygdB, yrfB, hdeB, and leuLP. Similar protein from Salmonella typhi CT18 encoded by STY3178 is functionally associated with: STY3179, STY2415, STY3241, STY4306, STY1786, STY2638, STY2653, STY3136, STY0411, and ydhZ. Such associations indicate that this putative membrane protein of unknown function (NCBI:PRK10316) may be functionally associated with regulation of fimbrial expression and/or response to leucine.


    Fig 1. Monomer of 390304

    GS14063a.monomer.png

     

    Fig 2. Tetramer of 390304

    GS14063a.tetramer.png

    Fig 3. Electrostatic surface of 390304 tetramer

    GS14063a.elec.png

     References

    Overexpression of the Response Regulator evgA of the Two-Component Signal Transduction System Modulates Multidrug Resistance Conferred by Multidrug Resistance Transporters. Kunihiko Nishino and Akihito Yamaguchi
    J Bacteriol. 2001 February; 183(4): 1455–1458. doi: 10.1128/JB.183.4.1455-1458.2001.

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     GS14063a.elec.png
    electrostatic surface of 390304 tetramer
    80.53 kB20:01, 16 Jul 2008qxuActions
     GS14063a.monomer.png
    390304 monomer
    72.87 kB00:40, 16 Jul 2008qxuActions
     GS14063a.tetramer.png
    Tetramer of 390304 in the asu
    210.34 kB00:36, 16 Jul 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch