The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 389851
    Molecular Characteristics
    Source Thermobifida fusca yx
    Alias Ids TPS7634,TFUS_04MAR05_CONTIG93_REVISED_GENE869 Molecular Weight 46686.43 Da.
    Residues 434 Isoelectric Point 5.76
    Sequence vasqtpgteaqsqtvqpgriaaislhtspldqpgtgdaggmnvyivevakrlaergiavdiftratsfe qppevelapgvtvrniaagpygtldktalinylcpfvhgmlraeaehlggsydlvhthywlsgqagwpv arewgvplvhsmhtmarvknmslaegdtpepeervrgedalvaladrliantddeaaqlinyygaspsr vstvfpgvdlttftpgsraeslrrlglpedtilllfvgrvqrlkapdvllraaarllelnpslrdrlvv avvggqsgtgyrepwllsdladslgiadlvrleppcpraelvhyyraatvtvvpshsesfglvavesqa cgtpvvaarvgglptavrdgvsgvlidghdphdyanvlhrmiteprwrermgaagihhasglswestvd gllaayrdalhqcrltvpcr
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch