The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 389053
    Molecular Characteristics
    Source Syntrophomonas wolfei subsp. wolfei
    Alias Ids TPS7586,YP_753184.1, PF05107, 87869 Molecular Weight 32781.63 Da.
    Residues 288 Isoelectric Point 6.04
    Sequence mattiknryefvlffdvengnpngdpdadnmpridpetsfglvsdvcikrkirnyvallkeneddyqiy vqekavlnnqhkkayehfkikpeskklpkdtaqaeaitqfmcknfydirtfgavmttevncgqvrgpvq lgfsrsldpivpqeititrmavtnerdlekertmgrkhivnyalyraegfisapladktgfseedlell wdalinmfdhdrsaargkmssrklyvfkhdsklgnapasilfdaitvkkingnkpvrnfsdyeisvtgn eipqgvevlell
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch