The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 388649
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS7540,YP_002938305.1, 87569 Molecular Weight 25312.37 Da.
    Residues 223 Isoelectric Point 6.32
    Sequence mktrqealdyglsfpntyqeapfhdpnwqlirvkdskkvflwtyerngfinlnvkvspawrdfwrdafp svipgwhqnkdnwntiildgsipddaiknmisdsydlvtynptrliyeavkripkgcvatyaqvaelag nkkmcravgnalhknpnpdeipcyrvvnakgelsgafafggadeqanrlradgievidgrvdldkygir ivddviytkttveplt
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch