.
The Open Protein Structure Annotation Network
PDB Keyword
.

388609

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 388609
    Molecular Characteristics
    Source Eubacterium rectale
    Alias Ids TPS7533, Molecular Weight 12463.56 Da.
    Residues 108 Isoelectric Point 4.86
    Sequence mitsiarqsiilkclrqksvlvsnyelyytaglakkcfgiavdadmepkqlleelqkhidkvspadeqekylihll gnyepddthdeqtvelfhmgeteehiwqvsit
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    RER070207001348 is from the Eubacterium rectale type strain ATCC 33656 genome, and belongs to a completely new family from human gut.  The over all structure is a helix-bundle protein.  The sequence alignment from NCBI blast  does not provide a clue about the possible function annotation since the sequence is very different from anything in genbank, COG and PDB etc.  Based on the predicted homologues Fold & Function Assignment System (FFAS) and SSM, no structural homolog can be found for this target. There is no Pfam assignment for target too.  There are four subunits in each symmetric unit. The interaction interface calculation can not suggest any stable interactions between subunits. 
     

    388609_1.png

     Figure 1. The Protein structure of RER070207001348

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     388609_1.png
    No description
    165.08 kB22:27, 23 Jul 2008kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch