.
The Open Protein Structure Annotation Network
PDB Keyword
.

387107

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 387107
    Molecular Characteristics
    Source Methanococcus maripaludis s2
    Alias Ids TPS7486,NP_988304.1 Molecular Weight 20555.64 Da.
    Residues 175 Isoelectric Point 6.00
    Sequence mekmvirnarktdideimnieydsfitgisenrnvfldriatfqngflvlevdsevlgyisseiweyse nidekmfdlnhdikkvhkcngselyissigilkkhrkkgygnllfkeliekisknykissmiltvsvnw kpaiklyekngfkeicrikeffededssdgivmrkyi
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch