.
The Open Protein Structure Annotation Network
PDB Keyword
.

386541

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 386541
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS33559,YP_209798.1, 327446 Molecular Weight 41364.33 Da.
    Residues 361 Isoelectric Point 4.68
    Sequence kelhesstiisfkehtdvnadsilelsflklqtkdsclvknvglirelnncllildsansnlyvfnksg afvnqigqkgsgpgeyillssffvdnnknyiaaidiaqdkvlyynatdfsflyerrlpfstscclqled gnllwnsreytdsklsdfyfvvtdslfdiidykmnkefksgyttgpsqmiykvgtnvfaytpfdltiyr vgtseivpahsfsfegtdipsldflnktsnqgnsnylydliqsdyisyycveeterdlfvcymknkeky iglydkntdrtynypikifqdqlkvgelnyfsigsvddyhvapldvlslkdmagngyvfddklsellti sneednsillfvrikk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch