The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 383851
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS7448,NPUN_22DEC03_CONTIG1_REVISED_GENENPF4281, BIG_252, 88344 Molecular Weight 14626.86 Da.
    Residues 131 Isoelectric Point 4.49
    Sequence mtrtfnpesygkllaeyqpkiittnaeneqaialaltlehrlnrtseeemllqllvtlieqfeethypi lngtpnsmlvhlmdardmttealaevlgslevalqivnggtisktqaealadyfnvnvslft
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch