The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 382494
    Molecular Characteristics
    Source Corynebacterium diphtheriae nctc 13129
    Alias Ids TPS7360,NP_939353.1, _0020.002700_, BIG_364, BIG_326, 283256 Molecular Weight 42555.89 Da.
    Residues 390 Isoelectric Point 5.00
    Sequence mrvammtkeyppeiyggagvhvaeltrhmrdivdvdvhcmgaprnednvytygfdpeltsanaalqtms tglrmahaaayadvvhshtwytglgghlagllhevphivtahslepdrpwkreqlgggydvsswseqna meyadvviavsagmkdailraypridadkirvvlngidtqlwqprptfddaehsvlrdlgikpdqpiva fvgritrqkgvehlvkaaryfspgvqlvlcagapdtpeiaartqhlveelqaeregvvwvqemlskdki qeiltaadafvcpsiyeplgivnleamacatavvasdvggipevvvdgttgslvhydpndtdtfehdla eavnamvtdrkraaafgvagrnravsefswgfiaqqtvdvyssll
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch