The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 381242
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS25209,MMAG_12JAN01_CONTIG3803_REVISED_GENE1594, PF02625, 382703 Molecular Weight 36415.57 Da.
    Residues 347 Isoelectric Point 5.19
    Sequence mcldaikcdpadmaaddcevlatalkwmdggrrvvmavvmatwgsaprsigsymavdadgtfagsvsgg cvesaviseardleegeaprllsfgvedetawavglpcggnirvavfhperdlleeavrsqasrrptal vldlnsgaqalvgdagvigplsldetrlvaaqmhlgqgtcgvvadevfvrtheapwtlivagavhitqv lagmarqagfavtvvdprrafadearfpgttlicgepdevlasitldrrsavvslthvprlddaalraa lgseafyigalgstrthakrcqrledlgpalkriaapvgfdigartpaeiavsilaeliaarrgkpmrvrg
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch