.
The Open Protein Structure Annotation Network
PDB Keyword
.

381163

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 381163
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS20128,JANN_22DEC04_CONTIG27_REVISED_GENE4063, BIG_836, BIG_846, 283434 Molecular Weight 41758.00 Da.
    Residues 387 Isoelectric Point 4.85
    Sequence mnkqvnfdelevgydvpalpgmdeadiqtpclvldldalernikkmgdyarehgmrhrvhgkmhksvdv aklqeelggacgvccqkvseaevfarggikdvmvsnqvtdpqkidrlarmpkfgarvlccvddpanvad lsaaavkhgtqiealveidcgagrcgvtttqevvniakmidaaeglkfagiqayqgamqhldsyderas ktqvaidmvedaiaglkanglecdivggggtgsyyfesnsgafnelqcgsyafmdadygrildkdgkri ddgewenalfiltsvmshakadkaivdaglkaqsvdsglatiygrddveyvkcsdehgvvmdpdgvlnv ndklrlvpghcdptcnvhdwyvgvrggkvetlwpvsargkay
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch