The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378920
    Molecular Characteristics
    Source Acidithiobacillus ferrooxidans atcc 23270
    Alias Ids TPS7128,AFE_0749, 285491 Molecular Weight 36894.76 Da.
    Residues 335 Isoelectric Point 5.18
    Sequence malrsmdelrqqaqgalslniafigvvnglfstlhalgnadsaalaaatgmdtgyvlrwcdaayafgwl eltdneqwrlsedgdrmrpeaensrvgvavgavlsahmaeraaglmrtgerpgekvlaeretilpwfgl mlennfrktfeekicptvpifaevdargglavdlgcgngwylralaarcghlhglgldgfaenirqate kaqsegiadrlhfdegdihqfslpepadliamnrslhhvwenrgeifqrlhaslkpegaiviwepawpd dhrvlrepplrgmafqnltehvqgnhflhpeeiatalseaglhpeifpfgsdvvvvgrv
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch