.
The Open Protein Structure Annotation Network
PDB Keyword
.

376513

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 376513
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS25690,NP_638504.1 Molecular Weight 9642.11 Da.
    Residues 92 Isoelectric Point 4.59
    Sequence ilkplgiayepskggpgpdvgpisakggawawlaqdgtdyfdlhhtaddtldkidpkalaqnvaaytvf aylaaeadgdfgsraksvqppne
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch