The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 376174
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS6907,SARO_25NOV03_CONTIG21_REVISED_GENE111, 335910 Molecular Weight 23281.04 Da.
    Residues 215 Isoelectric Point 5.53
    Sequence lsnasrpvarqprgdatrhailtaaetvfadlgyaaarledvaqvvgirrpsivyyfpgkrqlydevea difaamhafvvermaeasrpidrllaildawldffvqrptaariiqrlvadpgprsedpvefsgtalad feaiiasgvadgsfrevpamhilnsvaagalfyvcnarqlgagreydpadpailaqfratlhrqaiaav ghadqpqg
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch