.
The Open Protein Structure Annotation Network
PDB Keyword
.

375562

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 375562
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS6862,NP_068869.1, 3.40.640.10, 383098 Molecular Weight 41928.03 Da.
    Residues 371 Isoelectric Point 7.14
    Sequence mfkretkdfinidplqtggklteearqallewgdgysvcdfcttgrldeiktppihdfihnqlpkflgc dvarvtngareakfavmhslakkdawvvmdenchyssyvaaeraglnialvpktdypdyaitpenfaqt ieetkkrgevvlalitypdgnygnlpdvkkiakvcseydvpllvngayaigrmpvslkeigadfivgsg hksmaasgpigvmgmkeewaeivlrrsekyknkevellgctargatiitlmasfphvrerikrwdeeve karrfaaemeklgikqlgdnphnhdlmffhaevlyeiskkakggrfflyrelksrkihgikpgltryfk lstyglsdeevdyvlnafkeiiekys
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch