The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 375196
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS6836,NP_391137.1, 3.40.1190.20, 103984 Molecular Weight 30984.11 Da.
    Residues 284 Isoelectric Point 5.08
    Sequence mkliavgdnvvdyyqdqetfypggnalnvavlakrlghessyigivgndeaaahllnvlkleqvnadyi rqahgengmaivtldeqgdrifvrsnkggiqsrlrlafqekdvsfisghdllhtsvysrlendlpqlcg lvpvsfdfstnreddylrrvcpyvtyaffsgsdlsesecgelaktahgygakmvcmtrggqgailsagd rvyhqpiveadiidtlgagdsfiagfltafcvkqdityalrqaaetaaktcgvygafgygypyrledgg ssektril
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch