The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 374595
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS6772,NP_637315.1, PF03963, 92177 Molecular Weight 22651.09 Da.
    Residues 221 Isoelectric Point 4.76
    Sequence mstigsdlynslglttsskvakkedalgqadflklmteqlqhqdplkpmensaflgqlaqfstvqgigd lntkvgnfsdsmnsdqvlkgaalvghnvlvpsaqvaidatgsakgvvaatsagfvnfeitdangtfvkq lsvpasaagevsfawdgtdangnrmaagkygitatqtdtagaksklatyvdapvdsvtigsdglylnlt glgtsplanvlrvs
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch