.
The Open Protein Structure Annotation Network
PDB Keyword
.

373510

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 373510
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS6642,YP_001050042.1, BIG_1097, 285275 Molecular Weight 33696.83 Da.
    Residues 315 Isoelectric Point 5.53
    Sequence mangttpsvgialgsgaakgwahigvlnglaamgikpdkvagcsvgalvgaayahdhlpeleewvrsfs swdvlglmdirwrkggliggdkvfdvlqarigdvnienlnrpfaavatdlysgqeiwftegdlrqavra scsmpgilapvrqgdrwlvdgavvnpvpvsvsramgvdvviavdlygyhsgriqvlpvsmtsqknveae mdmsarqetgfmdlfargrdyvsnltdkfslgtksnpgmiavmsqsmgileqrhkrarlmgdppdiciv pevgnigtmefhradeaiaageaavekvahlieaalwkg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    THIS IS A CASP8 TARGET. DO NOT UPLOAD IMAGES OF THE PROTEIN STRUCTURE TO THIS PAGE.
    __________________

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch