The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 371983
    Molecular Characteristics
    Source Uncultured thermotogales bacterium
    Alias Ids TPS6564,104161998, 297483 Molecular Weight 12883.48 Da.
    Residues 116 Isoelectric Point 5.55
    Sequence mahevlilafegkkscflhallnaldmsekgfavsvvmegespslmkeitnekdpvheiyietkkrgli kavcygcskmmgvleivekeglplngdmrnhvplatyvergaeiitf
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch