.
The Open Protein Structure Annotation Network
PDB Keyword
.

371768

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 371768
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS6528,YP_752209.1 Molecular Weight 14113.46 Da.
    Residues 121 Isoelectric Point 4.88
    Sequence mqtkvinfndkfslfnqhwsprviaemndyqfklvkvegefvwhehadtdevfivmegtlqiafrdqni tlqagemyvipkgvehkpmakeeckimiieprgvvntgeidsdrtalndqwi
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    This protein, gi|114564695|ref|YP_752209.1|,  is a Cupin 2 conserved barrel domain protein from Shewanella frigidimarina NCIMB 400. It belongs to PFAM
    PF07883 (http://pfam.sanger.ac.uk/family?acc=PF07883).
    The protein is all b-stranded.

    Fig 1. Dimer is most likely the biologically relevant oligomer. Each monomer shows a Ni ion in the putative active site to which an unknown ligand (UNL) is bound. There are a couple of structural homologs of this protein: 2i45.pdb  2oa2.pdb. The His residues in the active site is conserved in 2i45, although no ligand/ion is bound therein.


    Fig 2. UNL bound to Ni ion in the active site.


    Ligand Summary

    Unknown ligand (UNL) bound to NI ion.

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch