The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 371698
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS6516,NP_765517.1,, 103530 Molecular Weight 17807.28 Da.
    Residues 154 Isoelectric Point 4.78
    Sequence mcdkdiynnkemiilnkqqvtkaiekvlnsskigvlstahhnkpnsrymvfynddlnlytktnvnslkv eeiennpdahillgynettnnsfveidatievvkdqkvidwlwetqdktffnskedpelcvlkviprsi klmnddeldtpatiel
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch