.
The Open Protein Structure Annotation Network
PDB Keyword
.

370610

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 370610
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS6453,YP_679412.1, BIG_349, PF04820 Molecular Weight 46286.33 Da.
    Residues 413 Isoelectric Point 6.00
    Sequence mqrekvdvlvigagpagtvaaslvnksgfkvkivekqkfprfvigesllprcmehldeagfldavkaqg fqqkfgakfvrgkeiadfnfsdqfsngwnwtwqvprgnfdktladeaarqgvdveyevgvtdikffgtd svttiedingnkreiearfiidasgygrviprmfgldkpsgfesrrtlfthikdvkrpvaaemegnrit avvhkpkvwiwvipfsngntsvgfvgepsyfdeytgtpeermramianeghiaerfkseeflfeprtie gyaisasklygdgfvltgnatefldpifssgatfamesgskggklavqflkgeevnwekdfvehmmqgi dtfrsfvtgwydgtlhavffaknpdpdhkrmicsvlagyvwdknnpfvkkhntilktlakviqmgeea
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    THIS IS A CASP8 TARGET. DO NOT UPLOAD IMAGES OF THE PROTEIN STRUCTURE TO THIS PAGE.
    __________________


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch