The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 369290
    Molecular Characteristics
    Source Synechococcus elongatus pcc 7942
    Alias Ids TPS6397,SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79420864 Molecular Weight 19314.98 Da.
    Residues 172 Isoelectric Point 5.76
    Sequence lsqsidldipkldridelaqelaaiqqtsskrvailgsrhvpithqhliemmsyalvlagnrlmtsgaq gtnaavirgamradpnlltvilpqsldrqpresreqlekvihlvehaendhlslaeastlcnqaivtrc qqlicfafhdshtlletcryaedqhhlvtlfyfd
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch