The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 368036
    Molecular Characteristics
    Source Lactobacillus casei atcc 334
    Alias Ids TPS6362,YP_807120.1, BIG_164, 90848 Molecular Weight 22611.29 Da.
    Residues 210 Isoelectric Point 4.20
    Sequence manelkvlegmdvvalarkhsdqatvsgqvipwqtslsfdpsvdsdstvtkdgnvatrssastdlevef lnntaaiadvmydslfdgelldfwilyrkrknsagkyyawymqvtvqedssdndpddhstrdvtfsvng tpkrgwttlddetqeqvdyvflgvgkvtdtdktgggtvwdkdvdpgtntadtapaqsssgtapaqggss tga
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch