.
The Open Protein Structure Annotation Network
PDB Keyword
.

367042

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 367042
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS6270,SSUI_28JUL04_CONTIG146_REVISED_GENE156 Molecular Weight 26630.99 Da.
    Residues 231 Isoelectric Point 4.92
    Sequence mkalifdvddtlydqiqpferalerhievareqieplylsfrryadevfeataigkmslkdshiyrmkh aladfgyqvsdatalaiqidydyfqgqielspvfpeifswcqaqgiamgiitngpyrhqlrkirtmglv nwfelehvlisgqvgitkpnpaifqlmeerlgmsgedicylgdsfendvvgakaanwkaiwfnhrkrve ptapyqadkvvtdwdelveviqsf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch