.
The Open Protein Structure Annotation Network
PDB Keyword
.

366117

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 366117
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS6203,NP_415290.1, PF04303 Molecular Weight 37057.41 Da.
    Residues 350 Isoelectric Point 5.57
    Sequence mkkipcvmmrggtsrgafllaehlpedqtqrdkilmaimgsgndleidgigggnpltskvaiisrssdp radvdylfaqvivheqrvdttpncgnmlsgvgafaiengliaatspvtrvrirnvntgtfieadvqtpn gvveyegsaridgvpgtaapvaltflnaagtktgkvfptdnqidyfddvpvtcidmampvviipaeylg ktgyelpaeldadkallariesirlqagkamglgdvsnmvipkpvlispaqkggainvryfmphschra laitgaiaissscalegtvtrqivpsvgygniniehpsgaldvhlsnegqdattlrasvirttrkifsg evylp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch