The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 361144
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS6049,SHEW_20DEC04_CONTIG148_REVISED_GENE1915, PF04820, BIG_357, BIG_349 Molecular Weight 47011.51 Da.
    Residues 424 Isoelectric Point 5.13
    Sequence vtpfaqtaaqtdhydvivigagpsgsvaasllhqqgkrvlvlekqhfprfsigesllpccmqviaeanm ldavnqagyqfkngaafnangrstyfdftdkftpgpgttfqvergdfdklladtaasqgveirygqrvd avdlshnprltisdeqgasyelsadylldasgfgrvlprlldlerpsnlpsrtaifthiqdnidsvdmg dyhfdrnkilisvhpdnrdiwywlipfsngrcslgvvgephllgqdadleatnleatlirlvreeprlk qllsraeiirkpaklagysanvstlasdkfallgnagefldpvfssgvtiamqsasiaakcvvkqlnge svdwqteyaqplmrgvdtfrtyvqawydgrfqdvifyqdpnpkikqmicsilagyawdesnpfvaeser rlnmvvelcr
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch