.
The Open Protein Structure Annotation Network
PDB Keyword
.

2lge

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the calcium-bound form of the protein YP_001302112.1 from Parabacteroides distasonis. To be Published
    Site JCSG
    PDB Id 2lge Target Id 394811
    Related PDB Ids 2lg7 
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS25384,YP_001302112.1, 325983 Molecular Weight 13737.56 Da.
    Residues 128 Isoelectric Point 4.28
    Sequence dddepggkgamyevtieqsgdfrsfiksvvvvangtqlkdgatgeslaspvilsdeelavekvtlsttg kaiefavsggvvdgedgvvnepmqwvvtvykngkeiekkslvfrdgkeistddlnlyyn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2lge

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch