.
The Open Protein Structure Annotation Network
PDB Keyword
.

2l25

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein NP_888769.1, a phage-related protein in the Bordetella bronchiseptica genome. To be Published
    Site JCSG
    PDB Id 2l25 Target Id 367705
    Molecular Characteristics
    Source Bordetella bronchiseptica rb50
    Alias Ids TPS6334,NP_888769.1, BIG_19, 86339 Molecular Weight 15187.41 Da.
    Residues 140 Isoelectric Point 6.73
    Sequence msqdliraafekrlsdwakartpalpvawqntkftppaagvylrayvmpaatisrdaagdhrqyrgvfq vnvvmpigdgsrsaeqvaaeldalfpvnlvmqsgglavrvrtpisngqpttgdadhtvpislgydvqfy pe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2l25
    1. Substrate selectivity and a novel role in inhibitor discrimination by residue 237 in the KPC-2 _-lactamase
    KM Papp-Wallace, M Taracila, JM Hornick - Antimicrobial agents , 2010 - Am Soc Microbiol
     
    2. Solution structure of gp17 from the Siphoviridae bacteriophage SPP1: Insights into its role in virion assembly
    B Chagot, I Auzat, M Gallopin, I Petitpas - Proteins: Structure, , 2012 - Wiley Online Library
     
    3. NMR structure of the Bordetella bronchiseptica protein NP_888769. 1 establishes a new phage_related protein family PF13554
    A Wahab, P Serrano, M Geralt, K Wthrich - Protein Science, 2011 - Wiley Online Library
     
    4. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     
    5. Long Noncontractile Tail Machines of Bacteriophages
    AR Davidson, L Cardarelli, LG Pell, DR Radford - Viral Molecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch