.
The Open Protein Structure Annotation Network
PDB Keyword
.

283706

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283706
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19924,TM1854 Molecular Weight 33480.28 Da.
    Residues 290 Isoelectric Point 9.90
    Sequence mslkrrearlgwglvsiyllytaifwgypfvwmlilafsrwkfvgspkfvglqnffrifedkifwrvfln tmnflsyfipmvfiasilfaialnrmkyfktfvtlsflvayvssgvaysimfqrifsetgpinrflyna fgitipwftdpqlamltiaimvtwkfvgyyglilysglqaipksifeaaeldgatswvkfwkitlplln paivtvlilavnlsfgiftepymitgggpmnrtltfmlymyntafqrinpsyattiaimtalinfsivi firkviekevtvv
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1854
    generated 12/2008
    Transmembrane protein

    HMM_TM1854

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch