.
The Open Protein Structure Annotation Network
PDB Keyword
.

283376

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283376
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26400,TM1519 Molecular Weight 25281.22 Da.
    Residues 236 Isoelectric Point 5.46
    Sequence mseldareiiemiakakkktpivayikgdlagidfssfkffgderfgilfgeyedfkklleehrekiedy hlevkarnsalpladltkykariepgaiirdmveigegavimmgavinvgavigegtmidmnavvggra iigkkchigagaviagvieppsakpvviedevlvganavilegvtvgkgavvaagavvtkdvppytvva gvparvikqidektkektkivdelrnle
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1519
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch