The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283300
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19614,TM1441 Molecular Weight 66491.46 Da.
    Residues 579 Isoelectric Point 5.27
    Sequence mlrthtcgelratdegkkvklcgwvdrirdlggvrfidlrdrygetqivcdvnseaysvvdeltresvvl vegtvrkrpegtenpnietgeievvaerieilsladplpfypgetpkeemrlkyryidlrsermkrnii lryriskiirdyfdelgfleietpfltrstpegardflvpsrlrpgkfyalpqspqlfkqilmisgfdr yfqivrcfrdedlradrqpeftqvdvemsfvdvedvlnvsegmvsrvfkessgidlkvpfdripyddam ekygtdkpdrrygmelrdfgyafettefkvirnvlneggsvkgfivpgfasemsrkkgeelmarmkelg lggliwfkldggitsphlkhlekefrkiaetenmnegdvcliaahtdrnllnealgtlrleigkehfsh lakgfdvlwvvdfpyfewseeeerfvarhhpftmpvletlgddytkvrakaydlvingyevgggsirih rrdiqekifellglseeeaqkkfgffleafrygvpphggiafgldrlvsiiagessireviafpktgng vclltgapaevderqlrelririeeg
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM1441
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch