The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283298
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19612,TM1439 Molecular Weight 25045.42 Da.
    Residues 218 Isoelectric Point 9.58
    Sequence mkkkeviklikehvesafsttdsssgvsttvqrreekdlnlprtydknklvlmpvnpyvvfaywdfdqrt relmkqkaregkavirlydvtfimfngtnahrtfehrldeltldagnfyfnvpmpradylsemgyldde gkfvsvlrsnvtrtpaaspsassrerwydlknkkrtvvlsegslikpvekirgvtspgfpsgqgmmaqg imweifrsgr
      BLAST   FFAS
    Ligand Information
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch