.
The Open Protein Structure Annotation Network
PDB Keyword
.

283276

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283276
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS25505,TM1415 Molecular Weight 25759.86 Da.
    Residues 232 Isoelectric Point 4.83
    Sequence mdnvekktgfkdivteidreaqrmivdeirkffpdenimaeegifekgdrlwiidpidgtinfvhglpnf sislayvengevklgvvhapalnetlyaeegsgaffngerirvsenasleecvgstgsyvdftgkfier mekrtrririlgsaalnaayvgagrvdffvtwrinpwdiaagliivkeaggmvtdfsgkeanafsknfi fsnglihdevvkvvnevveeiggk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

     

    Ligand Summary

     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch