.
The Open Protein Structure Annotation Network
PDB Keyword
.

283170

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283170
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32792,TM1306 Molecular Weight 16346.61 Da.
    Residues 144 Isoelectric Point 8.76
    Sequence meaavvvaysyfvlklefaisnpvmfacsflilvlsfistsfvfatlltlsknafswmstiqypvyfisg mlfpidilpkwirvissflpiswsvtlmrdsfevgsagkdlifnallltlfyfllghvlfkkierksra egelv
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1306

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch