.
The Open Protein Structure Annotation Network
PDB Keyword
.

283076

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283076
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS25543,TM1211 Molecular Weight 50841.40 Da.
    Residues 466 Isoelectric Point 8.48
    Sequence misllvavpllaafvslfwkkasdvlfslvalfnvivvlskwfpgvveihamgnwkppfginlvlddasf yaalivnliflmvsflpvetkkgyetslmlllgatngfvltgdlfnsfvfmeiititavttaakrenfy naykylilggiagsfyllatifaygatgslnmahiamvglsgssllavtmlytiglgveaklfplngwv pgvyggnevspivlgtavsfaalymlgrlfgtvfhgsglntlyvlslvtiltgemaalresrllrtfay ssvaqagvvaamiskgtenalnlayfhltndviakfviflvagflvysyrdlngvfrkhkllgisfsma tfslvgfpmfagfqskirmimeafstkdflfpavlliataievgyvirwnvrlwfeeetfeerskvplt igffsfalaillvvvflqpdvflegtqkmakalldtesyvngvfsavkggm
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1211

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch