.
The Open Protein Structure Annotation Network
PDB Keyword
.

282856

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282856
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19316,TM0987 Molecular Weight 115754.72 Da.
    Residues 1008 Isoelectric Point 6.42
    Sequence mktfleslkfpvqevnkkssgekgpgrppywemvfywtrkplvgarsviagallpenvdenlfkaavrls sptphrenpqipaefakyfegkklldpfagfgsipleglrlgldvtavellpttyiflkavleypkkfg kslvkdverwgewiteqlkndpeirelydddvavyigtweircphcgrwtpaignfwlarvkdgkgykr laymkperkgdeieirvidlneilddiskanvdgneiifegenyvktveeavrdgklkqsdvkidgntv ifevpsaniesrrdqltclmcgnvikyadengnhhmklkngdfyvkfalrkyhegderfarqrllvkvk vkdgdlifepatkedseklwkakekvremlekgdldvpseaiplyenrritpilsaekwyqffnprqll tlikivrlirevgrkveeekiaegwnkerafeyaeavatylstamlkyayynsivtrwdstwwkigetm strgiamnwnwtespwfssfggmiktllailrgvkyltsalsssqrtladftensvkvlqgdatslnlg ekfdvivtdppyaddvpytelsdfyyvwlkralsdvengkliprfhkeaffkrigpkwveiktqwqefa kkevstnpgrfmedenkkekavqhfenlfsqafvamrehlkddgvlvtyyahtdpgswinlieagwrra rlqitraiplttesetsivsrgkmsldtsivavwrkqkeektvqistlkeeierkakssarefieygye gldllygvmaaaleevtkyreisslkgpltteeilneyvypatirgivnaiaeiegtgtlhsgtamfyt aykilfgnaslsandivllrlatstdpselissgvlkekrsssskeytlytpdllgkkaldtkefqkfl hekkldpvepkpknsvdvlqlleyysllgrsrvkeeieklrkmwageveealfiarlvseyyaeiyirk idpvrrmkeefaseidrelekdgflevvlmrrllgyvggav
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Modeled
    Model
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch