.
The Open Protein Structure Annotation Network
PDB Keyword
.

282807

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282807
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19284,TM0938 Molecular Weight 29562.30 Da.
    Residues 254 Isoelectric Point 6.05
    Sequence mgniykrfarvfhegpytsfsrriaknfakilenfhirgkkvldvacgegtfaveiakqgfkvvgvdlss emlkfarkrakeesisvvflkkdmreldfheefdivtcwfdslnylldykdlkktfekvhealktggaf lfdmntvygllmanqegpvyiqqdgkdifevqtiefdleesvatfyvtvferkeeelwerfdeihrerg yrvkeiasalsetgfvfsfyedllskspltsysrrlwcaarkvsag
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Modeled
    Model
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch