.
The Open Protein Structure Annotation Network
PDB Keyword
.

282779

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 282779
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32934,TM0910 Molecular Weight 28756.01 Da.
    Residues 258 Isoelectric Point 4.64
    Sequence miletifsfleekflawmciftrftgffliapffserafpvvvrvllglftswlmlftvdvsiplntpvl sftlnlffnflvgfgigfivylflqafngagyifgfqigfgmeevlafgeeetnptgelvyfialtvfv likgpvllfeglkdsidvfpvnltgvtdgffsyivgrssdffvlilkigapviafmliisivlgivsrl ipqmnvfmvglplkviigvililgmlpiwadmaqkisalswnaiqellgk
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0910

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch