.
The Open Protein Structure Annotation Network
PDB Keyword
.

282719

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282719
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19226,TM0849 Molecular Weight 42355.71 Da.
    Residues 369 Isoelectric Point 7.02
    Sequence mkkekkdyyeilgvprdatqeeikraykrlvkewhpdrhpenrkeaeqrfkeiqeayevlsdpqkramyd rfgyvgeqptyqetesggffddifrdfenifnrdifdvffgerphqeerreyarrgediryeievtlsd lingaeipveyeryetcprcggtgvepnagymdcpscggtgrireerrsffgyfvsertcercggtgki preychecggsgrvlrkvrrtvkippnvedgthlritgggnagyyggpygdliiivrvkpdprfkksgs dlvydvtidylqailgttvevplpeggttmlkippgtqpetvfrlkgkglpnrygrrgdlivnvhveip kslsreerkvleelakkrgvtig
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0849
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch