The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282600
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19152,TM0730 Molecular Weight 16518.30 Da.
    Residues 149 Isoelectric Point 7.75
    Sequence mravvqrvseakvvvgeetvgaikkgllvfvgvgkndteedcewladkvsglrifededgkmnlsvkdin gevlvvsqftlygdcrrgkrpsfteaappdkgkalyekfvellrkkglkvetgkfrahmhvhlvndgpv tilldssklf
      BLAST   FFAS
    Ligand Information
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch