The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282581
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19134,TM0711 Molecular Weight 45612.68 Da.
    Residues 407 Isoelectric Point 5.00
    Sequence mkslrkilvlglvvisilllsqnikdlepdspffeavnyvvkagimelddkgnfrgallvtrydvaqyiy rlvmrfeleklkeklplldeldivkaatialdertsnleknynslnsrvdsavleitsaasevselktk idsleeafnnlslaftsfkqetagidseilrridvveknlkkleesskqntsrltlleknlenvskemt slkeavtqissdtrslltwkqdagedilmlkgrtgslseelnqlrkeldslssdvvnlknemnqkvsvv ssrvsaqeekvsdleksilqitakfqmlessvenlksdlenlnkrfsgleesvaedqqnrttmeseiqd lkkqvsdlskkierlssdltalsqrveekeksslqmdistlmvigagalalllgiillagr
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0711
    generated 12/2008
    Transmembrane protein


    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch