.
The Open Protein Structure Annotation Network
PDB Keyword
.

282435

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282435
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS33097,TM0562 Molecular Weight 21184.56 Da.
    Residues 182 Isoelectric Point 10.24
    Sequence mkrlkylllffatflfdnsgtpipiltatalisvgklkifpsfftiymgllswdtvtffagkklksvpfn lrwkfvqkilveflnvyifsekillplckfvpwvgkftpflagytgrnfptlliiwlgdllyestfffs sliagrvflkfskilgivlfavvilvyllwkrriskdivrhre
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0562

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch