.
The Open Protein Structure Annotation Network
PDB Keyword
.

282389

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282389
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18990,TM0516 Molecular Weight 34976.23 Da.
    Residues 305 Isoelectric Point 4.38
    Sequence MGNPSWINVFALVDYRSSSDTLYRVEEGLIPLETFDEINSGDPVVLSSFLNAYRGEDLSLLVIWNHGDWWRGESQK QVKGVAYDFVNLDFFTIKEIKSVLRDSPVTVLGFDACLMGTFEILWELKDCARYVVVSSKEAPGNGWDYSVLRYS KDLSSLLSNIVKRYGEIYGTEYSLSVWDTSKLDEIMLWLDRVAQYMIENNLSPWEFEVERRTAGGSTTELVELGS FAKSLQNSSDVVLREYGEGLYSAIVSARVYGTPDNYTDLTIYLPQNMKNPEYWDDFVALSDFTSESSWDDLIEHW RDKN
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Modeled
    Model
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch