.
The Open Protein Structure Annotation Network
PDB Keyword
.

282294

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282294
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS25487,TM0421 Molecular Weight 40384.93 Da.
    Residues 359 Isoelectric Point 8.31
    Sequence mpsirvvnlkkyfgkvkavdgvsfevkdgefvallgpsgcgktttllmlagiykptsgeiyfddvlvndi ppkyrevgmvfqnyalyphmtvfeniafplrarriskdevekrvveiarkllidnlldrkptqlsggqq qrvalaralvkqpkvllfdeplsnldanlrmimraeikhlqqelgitsvyvthdqaeamtmasriavfn qgklvqygtpdevydspknmfvasfignpptnflrdfsvsvenkqtilkrddviiklpepvdvklkevv vgirpehcrisrervensipgvvyvveplgrdiivnvktekgeiikvfgdtgkapqpgenvflvpdlrk ihlfnpeteetil
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch