.
The Open Protein Structure Annotation Network
PDB Keyword
.

282101

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Work Stopped
    Target Id 282101
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS25477,TM0221 Molecular Weight 60091.65 Da.
    Residues 532 Isoelectric Point 5.17
    Sequence mniverlrdlwkkivdlwnsmprerkflvggigialviaivlfavvasvphyrllvsglnedeagviiqk leemnvpykvspggdiyvpdsynvyelrmklasegvlgssrkgfsilsensfgatsfdkqvkyqialqe elersimtikgvkdarvhlvlpkytyyvrgemaeprasvlvvlepgaeltreqvrgivelvsgaveglk penvrvvdnysrslsdmletdegtflassklelkqqlekyyeskikkalesvfgpgrvevipdisinws kietemkkyeaparreglvrsqetqveksqnlpptggpagtdsnippltypsvtsegtstyerthtitn yelnevyqkiiqnregeisslsvaviidasssvlqnssdwssvindlvekgvgsitssaslsvavaflp fdrsieralqeelkqietrrrfvlysvgiallgfltfmliylmivqirrirarklaeerrrkleeevke ilqeelkeeevspeekellelleelenifsrspsdiaeivrlwfferg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch