.
The Open Protein Structure Annotation Network
PDB Keyword
.

282060

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282060
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32974,TM0180 Molecular Weight 20468.99 Da.
    Residues 189 Isoelectric Point 4.54
    Sequence mkrvliwsalitagilvlisgcipvpipidlgnlgiepqvfeipagssstlettsasftvkaedvknaqq kagvpgtvhfhnievsgkitvegdlrfvgfirfaleepsstpttgdvtiridtsqeseysfpisaddsd alrtalnrinngedvtlwvifgqneyesttgatvtvtitnvrlwvtwtaw
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0180

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch